HORDB

ID: hor000098
Uniprot ID: P01180
Protein name: Neurophysin 2
Gene name: AVP
Organism: Bos taurus (Bovine)
Family: Vasopressin/oxytocin family
Source: animal
Expression: hypothalamus
Disease: NA
Comments: NA
Taxonomy: Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005185 neurohypophyseal hormone activity; GO:0031894 V1A vasopressin receptor binding
GO BP: GO:0007165 signal transduction; GO:0042310 vasoconstriction; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030141 secretory granule

Sequence: AMSDLELRQCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCNDESCVTEPECREGVGFPRRV
Length: 95(32-126)
Propeptide: MPDATLPACFLSLLAFTSACYFQNCPRGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCNDESCVTEPECREGVGFPRRVRANDRSNATLLDGPSGALLLRLVQLAGAPEPAEPAQPGVY
Signal peptide: MPDATLPACFLSLLAFTSA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Bind vasopressin
Mechanism: Fetal neurophysin is the major neurophysin present in the neurohypophysis of 7 to 9 month fetuses and its sequence appears to be identical with that of the adult.
Cross BBB: NA
Target: AVPR2, AVPR1A
Target Unid: P48044, F6PV87
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor000098_AF2.pdb

hor000098_ESM.pdb

Mass:	1155810	Formula:	C404H646N124O135S15
Absent amino acids:	HW	Common amino acids:	GC
pI:	4.55	Basic residues:	9
Polar residues:	40	Hydrophobic residues:	21
Hydrophobicity:	-25.16	Boman Index:	-15442
Half-Life:	4.4 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	51.37
Instability Index:	5867.26	Extinction Coefficient cystines:	2365
Absorbance 280nm:	25.16